IP: 209.99.64.70

Here's what we have for this ip address:

Host name: 209-99-64-70.fwd.datafoundry.com
 
Country: United States (US)
State/Province: Texas
City: Austin
Zip/Postal code: 78728
 
Last updated: Oct-31-2019

Domains on ip :209.99.64.70

webtunity.comcons-rad.comanimalrightsgroups.orgvashabio.comzuliantuan.comtour.walesrisingriskreport.comenchantedhoneymoonstravel.comamericinn.sucksexecutivestones.commontanamadeintheusa.comshemalesmasturbation.comalghnanim.com3voconsulting.combluetooth.biqidiangonghuo.comagncholdings.netdiozzi.comigenidea.commagnoliafloral.cagetlyrichearingaid.comthewholeguitarist.commarkshermansimpson.netspankedredbums.comteenytoilet.comcuttingedgephysicaltherapy.comkendohelsinki.org0571biao.comwalking-horse.comdorancylaw.comerg.inkneteamweb.commontanawesternart.comigefo.com3dayblinds.clubcanadagoose-parka-online.comhylsf.comroaddogsdirtrelief.comhorizonemergency.comespaimarx.orgmarlawright.comimprovschool.com52xicheqi.comknox.vegascafeannie.comzzmayabbs.com2000ad.mediayouthbuildtexas.orgagnc.bizmblogcommunity.comhenleyandhenleylaw.comqualityleap.comphuketproperties.comarubabenihana.comjewelsformoms.comspilk-it.netwarriorheadquarters.comglenwesley.commichaelhvac.netmontechssori.comunitededa.orgkabakbeachhotel.comjoshuaradin.co.ukbluetooth.agpiamed.orgcharlottedaytours.comdentalkiduniversity.combesea.orgscottclarkchryslerjeepdodge.comthemenopausebook.comexoticpet.comkearsargemaplefestival.orgpapelaw.compremium-proxies.compropertymanageroklahomacityok.comningbo95.comjlfs888.comfslxhr.comcompanionpetsolutions.comcheapbeatsbydreme.combluewaterhorizon.comsdtavel.comnsfashion.cabuynolvadexonlineweb.comcfesi.comround5.com1becomesmany.combaitcastbuddy.comproductmanagementlifecycle.comnexus-enterprises.comlouisvillekyroofingservices.comchipps.educationmollym.comstablerclinic.comedtaplus.compair-pals.comarroyogranderanch.comreputaciononlinepersonal.orgjustinvesting.comjacksonfamilywines.vinlommenabdo.adultillinoisschoolcounselor.comhockeyfightsdump.comdiendandanang.commartzgroupva.onlinezociit.orgchaussuresblouboutinpascher.comorletmedia.comburberryhandbagshome.comillustriouslabs.xyzsmokymtngunstv.com770law.comalexsandahl.comfupomm.comspicegrill.commonumenthp.comlightstore.orgdentontx.newsimeaning.biziloveoceans.comcasualgamesdl.comcreativesoundstudios.compinboyewu.comcarolinabutterflies.combullseyeletterpress.comsyne-up.cayjzhidao.com55smartshoes.comprowindsdirect.comhelioron.comheartdoctorbook.comtechnoeconomic.comkidsretreat.orgpinespringsranch.camptownbluepages.comhemataus.compolypag.comdccheckin.comhuataiship.commrsteamreviewed.com407owners.comoxfordbusmuseum.co.ukhomehealthcarewatertownny.comfontenelleforest.bizamanwithadrone.comgravityranchmedia.compalmbeach-estepona.comknightsofcanterbury.comm-station.comcclccn.competergweiner.comambertinsley.comwhitebrookfarms.comidontcarestuff.bizpoolrepairscapecoralfl.combuylawncare.netxerxesforgents.comfreshzone.eucdrcgs.comwadieadjekum.comcnnctc.comalaskaterminals.comfreshtightpussy.comirismovies.combenensoncapital.infosafesiteid.comroofingcompanyavon.com13newsnow.videokeldmanninnovation.comstbllaw.comdarkprotect.netaircables.comalaskadogsledtours.comktaonline.comeconomie.netmainframeit.bizseedsnsprouts.combluetooth.amjerseykeswick.orgtextvin.comcasquebeatsdrefrance.comdermatologistinbatonrouge.compumpdoctor.netmerchantconstructon.com666.gdfountainpenbooks.comgenoa-umc.com20barrels.comgolftoendalzheimers.comelitehockeyshooters.caperpetualdonations.infoinvestbiotech.comrealtyleadservices.comsvncloud.comconstructionsafety.trainingmycardiologydoctor.comthatgirl.tvchickfightsdump.commushgoods.comclevelandwebdesign.agencyexpresoviajes.netbesaustintx.comlite-light.comannapolisboatrentals.netoutdoored.xyzfueleyewear.comkimmellaw.comsongwagon.comassociatednewsnetwork.comporto-romano.comnewdeal20.orgmawrahocane.comsar-bus.comthedentistsservice.companycohorttrust.netaccountantnaplesfl.comdanhcotuong.comuk4groups.comeduegov.comwix.agencyrobertmurraylaw.comlovatoy.comfooyauyuan.comtunter.comcorporatewebdesign.comzociit.comdreamappliance.comiyypf.comwwwmatch.seeloquentprose.comrecettes-cuisine.orgninepointtwocapital.combostonterrierpuppies.comworlddatingsite.combaskinnyc.comsg-intrests.comkemetians.comrischoolcounselor.comandyshowto.comtieroneguns.come-enabledadvantage.infoforeignfield.netgoing.tocateringablaze.commarekandassociates.comsalutarismd.eu95bjoa.comazprep.educationgoldeneye2000.compinkzoo.comvisionstop.comhighalberta.comknickerbocker.vgfyfllc.comamerimhealth.combillnortoncreative.comgeorgiamartyrs.orgunlockourjobs.orgtuprivacidadigital.netanchorbaytech.competitamuse.com77foundation.orgyrmsmcy.comcarefluentsolutions.orgkeniley.comargentinayell.comsnowtotalreports.combowlinggreenkychiropractor.comspilk-it.comlawyergroup.nettrumpini.inforenegadesliquors.comfetish-lolita.comfhr.orgcretego.comkevinglidewell.comdunlap-properties.comvegasromantic.comgiorgiogalli.comguidancepoint.infoharleyingleby.comglobaltranz.orgraffcap.netluvsportswear.comtotalgeni.usalzheimersdayservices.combrugesoriginals.comgottadance.complasticosblast.comhempnsave.comlsddc.comcesc-km.comtheiaseniorcare.comhobsonsparframework.comcheapfashionshoesaus.compulsiam.wikidevelopmentsite.orgcn-spjx.comaffandionline.comcheaplouisvuittonireland.comfuturecall.orgmarcelluswealthhelp.investmentsredwoodsinsurancegroup.netdrmolarmagic.comfranksteele.comproxbot.comanniemcknight.combnxie.comappliedmathchallenge.comprorail-uk.comdiscuver.comsammynebraska.orgaroundtownlimousine.combohaifactrong.cominsurance4travelers.comekhitba.comprezzirealtor.comyouthbuildpennsylvania.orgwtsp.videone-0ne.com0831hotel.comportlandorhousesforsale.comniagaragunrange.comzhongbaoic.comstandupguy.bizbrooklynmusiclessons.comdfginc.netarcteryxoutletcanada.comkmzhongya.comyieldfind.comrelocationagentpro.commyexchangediscount.netoccidentalwarrior.comjohnsonsenterprises.co.ukparliament.hnisopink.comnicolamcdonald.comencuentrate.comkimptonmiamibeach.comglobalclouds.netfnbt.helpgbc.educationyycle.comwix.educationmikedaisley.comfreeeportlng.comhottest-pornstar.comdenverrealestateonline.comtext-centric.comolove.comahainitiatives.comonlinementor.educationpreprod-iussp.onlinelatandl.comtheunjustmedia.comboleader.commayerusa.combluemountainfilmfestival.commasterpiecedoor.nethappierworks.comadoptiondirect.comthecaddyshackputter.commackinaw.venturestakeyourkidcamping.comlongislandgreenhomes.comblackdogroad.comkeepgreenvillebeautiful.orgls-csc.comkennady.comelevenpenn.comoswegodrywall.netbarnhartphotography.netmalci.emailmatchsweden.seathleticdept.comcnchyzd-b.comhudsoninstitute.orgnnikookar.comalistauto.comtklantv.comaksteelonline.bizaspectleds.commerrilldoug.comacerbrag.netvoguewine125.comossecu.comthuocphothong.comdashfy.comthepizzamarket.caeleganceinbusiness.comartattack4u.comeli-help.comrainydayrelieffund.comlightcloak.comlocalkitchenremodelingorlandofl.comephr.healthcaremypurpleglobe.comlisaberkley.orgsiriusxmtcpasettlement.comrolos-cafe.comgreatlakes-erag.organuvaenterprises.comhomoineptus.orgneuropsych.servicesdrhippy.comwebexpedite.comszrdsk.comlakeclaiborne.comubrhug.netesac-1.comgoldenbabies.netymfdsb.comcolloidal.infolvyumm.comascentfloors.comcarepax.orgchinacml.comstashskate.comminidyer.comoutsource-website-development.comunlvip.commissioncontrolentertainment.comatcomaart.comventuracountysoccer.comgettingitright.fitnesskellyannwulbern.comcourses.tozgjtdmh.comcaffevivaldi.comfuwangzs.comwix.weddingdhbwerks.comfireeducationhouse.commcarthurlaw.comitmonitoringservices.combroadviewparkdistrict.orgnutrismart.orgmageerehab.commaggie-wilson.comhectorsilveira.comletalondechaine.orguglybaby.clothingxfnc-agri.combaisch.engineeringbrookhillfurniture.comampidcorp.comcolombianflowers.orgmcferran.carevitalifewellnesscenter.compjsconcretepools.bizbvlgariringsok.comemikokyogoku.orgmithnet.comwlbz2.videoservemy.usaclsonlinecourse.comheavenshealthyhemp.commlcc.netyorkvilleilwindow.comcbcjax.orgcelinebagja.comtopoftheslide.comcfakaoshi.comarveenagritrade.comrsbuchanan.netbloggertariat.comatumedico.comfucksnapnames.comtribarmanufacturing.comfreedomtosurf.orgzsxhnk.comcdfdslc.comlarrywhipperpeoplepower.orgcarpecosmos.orgitbrainpower.infoenersolar.bizmayone.orgjhly100.comxjhj518.comnancysgaragesale.comblazecannabis.comstarfuel.netbuywowwarlock.comsonapdata.comrickyanimation.comsalonartisanslongueuil.comd-ina-b.comidkits.comnewdaynewbackyard.combsheaffer.comhubzonejobs.netbxiny.comngmead.comrjguitar.comphilperry.nethkiinsurance.commudandticks.comtheplacetobe.beproactimes.orgleadermortgage.biz
 
 

Find IP address location (country, state, city), or IP address by domain name.

For bulk check, enter up to 20 IP's OR domains:
(separate IP with space, comma or enter one per line)

IP location query results:
 

IP 
Country State/Province City
209.99.64.70 
United States Texas Austin